PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn044311
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 954aa    MW: 105998 Da    PI: 6.7885
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn044311genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.27.7e-08204246347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
       Achn044311 204 AWTRQEEESFFTALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 246
                      6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5162516.2191188IPR003358tRNA (guanine-N-7) methyltransferase, Trmb type
SuperFamilySSF466895.91E-10198251IPR009057Homeodomain-like
PROSITE profilePS5129313.416200251IPR017884SANT domain
SMARTSM007172.7E-6201249IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-5203249IPR009057Homeodomain-like
PfamPF002496.9E-6204246IPR001005SANT/Myb domain
CDDcd001679.11E-6204247No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006400Biological ProcesstRNA modification
GO:0003677Molecular FunctionDNA binding
GO:0008176Molecular FunctiontRNA (guanine-N7-)-methyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 954 aa     Download sequence    Send to blast
MACTALMRVS SSVSFRNMVD NVSVVWEILK GRQLPGLMAL DRLVSRCLAS VHRSGMKNGF  60
PSGFPFNHPP PTPPHAPGLI FLWCPNPDFN KPEHRWSMVQ RILVEAIADL LASDGKVFLQ  120
SDIEAVAVRM EGQFLQYGKG KLAIMQDHSD VNIGQGRWLK ENPFGVRSDW EQHVIDRGDS  180
MYRVMLSKSP IFNAAKKQTR QWAAWTRQEE ESFFTALRQV GKNFEKITSR VQSKNKDQVR  240
HYYYRLVRRM NKLLGPGLCL DAKNSKDTNA AMLRWWSLLE KYSCKASKLH LKPRRLKIFI  300
EALEDQLLKD RRKSKRKQPS HGENCSPAIP TNVSNQGRAS GHDTHAVKLV LVDSQKIKKL  360
GPVKGTSVRR NVNVGINRSN CKGDSFPAKT VRQRRRPAAY KRWEKAAIAG VSLVADAAEH  420
LERATIDKEV EHVQENGFDP VRTDPPLPTS SPNFVNDNNT QTSTKLKLQL FPIEEGTRRA  480
LEMDNHNPHL ELTLSTRKKI SSVLEHLNRK WGNSSVATGE LMLFPYFVQI EKLVGYQRWT  540
QDSVVNAADV YSLIGSPPVF RLRYGWFSNA ELVAAASQAR LESSGMILNL NMKVNNTKEH  600
SHSVLETTPP ITCHHSNKDQ QVFEAENTSV LPSSPEASTE VIRFVGVDGN NNIPQSSDGA  660
ATVPRDRRET DNGAILRGGG NKDDPQLRNG PALSAGEWAD SLTNISLGDL LSEVNCVDPP  720
MPGNSQCLQQ CSFSCDSFDA AIAAHIHRHQ NKTSFPPPMA SLASSIWDAE DTCDGFLFQN  780
TVLREDIRTA STIASSEACK QICRMSSAGS GATVEDLPEM EVPMEDNPVD EEPMEENPDD  840
EGSEDDNPAN GDPVDECLSP TILENSAKDF NGLTDMYWPD SLGPLDLDLP TSRYHTEDLI  900
LSDSLRGLNR LLASSLDAFQ NCSFFGLDKK EMASTVEAQG TASFQDYKIG SGV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1310316RRKSKRK
2310317RRKSKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010653605.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X1
RefseqXP_010653606.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X1
RefseqXP_010653607.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X1
RefseqXP_010653608.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X2
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLD7TQP70.0D7TQP7_VITVI; Putative uncharacterized protein
STRINGVIT_08s0040g01460.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA86401719
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.30.0TSL-kinase interacting protein 1